Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q913A6

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ayw (isolate China/Tibet127/2002) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNPNKDHWPKANQVRAG AFGPGFTPPHCSLLGWSPQAQGILTTVPAAPPPASSNRQSGKQPTPISPPLRDSHPQAMQ WNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTP AQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCF1 (NM_152397) Human Recombinant Protein
TP761321 50 µg

IQCF1 (NM_152397) Human Recombinant Protein

Sign In for Pricing
View Details
PPP2R1B (NM_181700) Human Over-expression Lysate
LY433334 100 µg

PPP2R1B (NM_181700) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF647 conjugate, 0.1mg/mL
BNC472179-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NIPSNAP1 Human Gene Knockout Kit (CRISPR)
KN401270 1 Kit

NIPSNAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SATB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E12]
TA500578AM 100 µL

SATB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E12]

Sign In for Pricing
View Details
Perfluorotripropylamine
TRC-P286575-25G 25 g

Perfluorotripropylamine

Sign In for Pricing
View Details