Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q913A6

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ayw (isolate China/Tibet127/2002) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNPNKDHWPKANQVRAG AFGPGFTPPHCSLLGWSPQAQGILTTVPAAPPPASSNRQSGKQPTPISPPLRDSHPQAMQ WNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTP AQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(4-hydroxyphenyl) Sulfone O-Beta-D-Glucuronide-d8 Sodium Salt
TRC-B447398-1MG 1 mg

Bis(4-hydroxyphenyl) Sulfone O-Beta-D-Glucuronide-d8 Sodium Salt

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester
TRC-B565960-10MG 10 mg

1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester

Sign In for Pricing
View Details
RHCG Rabbit Polyclonal Antibody
TA371483 100 µL

RHCG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tbata Mouse Gene Knockout Kit (CRISPR)
KN517232 1 Kit

Tbata Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smc6 Mouse Gene Knockout Kit (CRISPR)
KN516300 1 Kit

Smc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZDHHC4 activation kit by CRISPRa
GA110551 1 Kit

Human ZDHHC4 activation kit by CRISPRa

Sign In for Pricing
View Details