Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9E6S4

Expression Region

2-400

Origin

Hepatitis B virus genotype C (isolate Vietnam/3270/2000) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAG AFGPGFTPPHGSLLGWSPQAQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HnRNP K Rabbit pAb
orb2714902-01 50 µL

HnRNP K Rabbit pAb

Sign In for Pricing
View Details
HnRNP K Rabbit pAb
orb2714902-02 100 µL

HnRNP K Rabbit pAb

Sign In for Pricing
View Details
PTGFRN, ID (PTGFRN, CD9P1, EWIF, FPRP, KIAA1436, Prostaglandin F2 receptor negative regulator, CD9 partner 1, Glu-Trp-Ile EWI motif-containing protein F, Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protei
MBS6338716-01 0.1 mL

PTGFRN, ID (PTGFRN, CD9P1, EWIF, FPRP, KIAA1436, Prostaglandin F2 receptor negative regulator, CD9 partner 1, Glu-Trp-Ile EWI motif-containing protein F, Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protei

Sign In for Pricing
View Details
PTGFRN, ID (PTGFRN, CD9P1, EWIF, FPRP, KIAA1436, Prostaglandin F2 receptor negative regulator, CD9 partner 1, Glu-Trp-Ile EWI motif-containing protein F, Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protei
MBS6338716-02 5x 0.1 mL

PTGFRN, ID (PTGFRN, CD9P1, EWIF, FPRP, KIAA1436, Prostaglandin F2 receptor negative regulator, CD9 partner 1, Glu-Trp-Ile EWI motif-containing protein F, Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protei

Sign In for Pricing
View Details
MTHFR Rabbit Polyclonal Antibody (PE-Cy5)
orb895393 100 µL

MTHFR Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Boc-4-hydroxy-D-phenylglycine
sc-326390A 5 g

Boc-4-hydroxy-D-phenylglycine

Sign In for Pricing
View Details