Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9E6S4

Expression Region

2-400

Origin

Hepatitis B virus genotype C (isolate Vietnam/3270/2000) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAG AFGPGFTPPHGSLLGWSPQAQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAR22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV753811 1.0 µg DNA

TRNAR22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit
abx097915-01 50 Reactions

mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit

Sign In for Pricing
View Details
mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit
abx097915-02 100 Reactions

mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit

Sign In for Pricing
View Details
mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit
abx097915-03 200 Reactions

mmu-mir-470 Real-Time RT-PCR Detection and cel-mir-39-3p Calibration Kit

Sign In for Pricing
View Details
HMG4 Rabbit Monoclonal Antibody
orb1147453 100 µL

HMG4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FSH R Antibody (FSHR/1400) [HRP]
NBP2-54329H 100 µL

Mouse Monoclonal FSH R Antibody (FSHR/1400) [HRP]

Sign In for Pricing
View Details