Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B2 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9QAB7

Expression Region

2-400

Origin

Hepatitis B virus genotype B2 (isolate Vietnam/9873/1997) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDANKVGVG AFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTSRQSGRQPTPLSPPLRDTHPQAMQ WNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTGDPVPNMENISSG LLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGQTPVCLGQNSQSQISSHSLTCCPP ICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCKTCTTP AQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWFWGPSLCNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C2orf76 activation kit by CRISPRa
GA115109 1 Kit

Human C2orf76 activation kit by CRISPRa

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL
BNC400708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF640R conjugate, 0.1mg/mL
BNC402887-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Cytokeratin 8 Recombinant Rabbit Monoclonal Antibody [SU0338]
HA720118F 100 µL

iFluor™ 594 Conjugated Cytokeratin 8 Recombinant Rabbit Monoclonal Antibody [SU0338]

Sign In for Pricing
View Details
Polystyrene AM COOH
H16020003.100G 100 g

Polystyrene AM COOH

Sign In for Pricing
View Details
Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF640R conjugate, 0.1mg/mL
BNC402190-100 1x 100 µL

Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details