Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B2 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9PWW3

Expression Region

2-400

Origin

Hepatitis B virus genotype B2 (isolate Vietnam/16091/1992) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDANKVGVG AFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQ WNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTGDPVPNMENIASG LLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPP ICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTP AQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Layilin/LAYN Protein (Fc Tag)
PKSH031760 100 µg

Recombinant Human Layilin/LAYN Protein (Fc Tag)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]
E-AB-F1153P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD134/OX40 Antibody[Ber-ACT35]

Sign In for Pricing
View Details
CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]
TA506391BM 100 µL

CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
RD-ANXA2-Hu-01 96 Tests

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details