Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Gap junction alpha-8 protein (GJA8)

This Recombinant Chicken Gap junction alpha-8 protein (GJA8) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Gap junction alpha-8 protein, Connexin-45.6, Cx45.6

UniProt

P36381

Expression Region

2-400

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEVD EEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRILP LYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRRP AEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEFE EKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEEE VVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details