Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype F2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype F2 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q05496

Expression Region

2-400

Origin

Hepatitis B virus genotype F2 (isolate Brazil/w4B) (HBV-F)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDSWPMANKVGVG GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSG LLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), Biotin conjugate, 0.1mg/mL
BNCB0253-100 1x 100 µL

Cytokeratin, LMW (AE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF594 conjugate, 0.1mg/mL
BNC941097-500 1x 500 µL

CD44 Standard (HCAM/1097), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL
BNC042644-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC909), CF568 conjugate, 0.1mg/mL
BNC680909-500 1x 500 µL

C-Myc (MYC909), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details