Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P12934

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDHWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTGDPAPNMENTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEGASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hykk Mouse siRNA Oligo Duplex (Locus ID 235386)
SR412678 1 Kit

Hykk Mouse siRNA Oligo Duplex (Locus ID 235386)

Sign In for Pricing
View Details
AMPK1, phosphorylated (Ser485/Ser491)
520063-01 100 µL

AMPK1, phosphorylated (Ser485/Ser491)

Sign In for Pricing
View Details
AMPK1, phosphorylated (Ser485/Ser491)
520063-02 200 µL

AMPK1, phosphorylated (Ser485/Ser491)

Sign In for Pricing
View Details
NALP6 CRISPR Activation Plasmid (h)
sc-404548-ACT 20 µg

NALP6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
ESD Polyclonal Antibody
ANT-12074-50ug 50 µg

ESD Polyclonal Antibody

Sign In for Pricing
View Details
Mri1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7413903 1.0 µg DNA

Mri1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details