Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A1 subtype adw2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A1 subtype adw2 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P31873

Expression Region

2-400

Origin

Hepatitis B virus genotype A1 subtype adw2 (isolate Southern-Africa/Cai) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVG AFGPGFTPPHGGLLGWSSQAQGTLHTVPAVPPPASTNRQTGRQPTPISPPLRDSHPQAMQ WNSTAFQQALQDPRVRGLFFPAGGSSSGTVNPAPNIASHISSISSRTGDPALNMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTP AQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Big Endothelin (Big ET) ELISA Kit
NSL1068Gp 96 Tests

Guinea pig Big Endothelin (Big ET) ELISA Kit

Sign In for Pricing
View Details
D-Dimer Mouse Monoclonal Antibody [Clone ID: OTI12A5]
TA813911 100 µL

D-Dimer Mouse Monoclonal Antibody [Clone ID: OTI12A5]

Sign In for Pricing
View Details
GYPC Knockout Hela Polyclonal Cells
ARG25517 1 Million

GYPC Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF640R conjugate, 0.1mg/mL
BNC403462-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBFA siRNA (Mouse)
orb1841544-01 15 nmol

RBFA siRNA (Mouse)

Sign In for Pricing
View Details
RBFA siRNA (Mouse)
orb1841544-02 30 nmol

RBFA siRNA (Mouse)

Sign In for Pricing
View Details