Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A1 subtype adw2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A1 subtype adw2 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P31873

Expression Region

2-400

Origin

Hepatitis B virus genotype A1 subtype adw2 (isolate Southern-Africa/Cai) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVG AFGPGFTPPHGGLLGWSSQAQGTLHTVPAVPPPASTNRQTGRQPTPISPPLRDSHPQAMQ WNSTAFQQALQDPRVRGLFFPAGGSSSGTVNPAPNIASHISSISSRTGDPALNMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTP AQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-01 0.02 mg (E-Coli)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-02 0.1 mg (E-Coli)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-03 0.02 mg (Yeast)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-04 0.1 mg (Yeast)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-05 0.02 mg (Baculovirus)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 6B Protein B1 (B1)
MBS1412242-06 0.02 mg (Mammalian-Cell)

Recombinant Human herpesvirus 6B Protein B1 (B1)

Sign In for Pricing
View Details