Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P31869

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ar (isolate Japan/S-207/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2 (NM_172222) Rat Tagged ORF Clone Lentiviral Particle
RR206283L4V 200 µL

C2 (NM_172222) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Prss28 activation kit by CRISPRa
GA212430 1 Kit

Mouse Prss28 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF516 Recombinant Protein Antigen
NBP1-93685PEP 0.1 mL

ZNF516 Recombinant Protein Antigen

Sign In for Pricing
View Details
4-Nitrobenzenediazonium tetrafluoroborate
PC10103-01 1 g

4-Nitrobenzenediazonium tetrafluoroborate

Sign In for Pricing
View Details
4-Nitrobenzenediazonium tetrafluoroborate
PC10103-02 5 g

4-Nitrobenzenediazonium tetrafluoroborate

Sign In for Pricing
View Details
4-Nitrobenzenediazonium tetrafluoroborate
PC10103-03 25 g

4-Nitrobenzenediazonium tetrafluoroborate

Sign In for Pricing
View Details