Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P31869

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ar (isolate Japan/S-207/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF93 (TRIM15) Rabbit Polyclonal Antibody
TA382804 100 µL

RNF93 (TRIM15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Snx2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4785608 1.0 µg DNA

Snx2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Ly6G6d shRNA Plasmid (h)
sc-95424-SH 20 µg

Ly6G6d shRNA Plasmid (h)

Sign In for Pricing
View Details
Glucoallosamidin B
orb3024584-01 50 mg

Glucoallosamidin B

Sign In for Pricing
View Details
Glucoallosamidin B
orb3024584-02 10 mg

Glucoallosamidin B

Sign In for Pricing
View Details
Mouse Anti-Human CD10 mAb (PE/Cy7)
orb2710009 100 Tests

Mouse Anti-Human CD10 mAb (PE/Cy7)

Sign In for Pricing
View Details