Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P31869

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ar (isolate Japan/S-207/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotensin (Human Proneurotensin, Large Neuromedin N, Neuromedin N Preproprotein, NMN-125, NN, NT, NT/N, NTRH, NTS, NTS1, Proneuromedin N mRNA, Tail Peptide) discontinued
N2177-13 250 µL

Neurotensin (Human Proneurotensin, Large Neuromedin N, Neuromedin N Preproprotein, NMN-125, NN, NT, NT/N, NTRH, NTS, NTS1, Proneuromedin N mRNA, Tail Peptide) discontinued

Sign In for Pricing
View Details
Anti-JunD Rabbit pAb
GB115519-100 100 μL

Anti-JunD Rabbit pAb

Sign In for Pricing
View Details
ERCC1 (Excision Repair Cross Complement Group 1) (BSA & Azide Free) (MaxLight 490) discontinued
E3451-50AX-ML490 100 µL

ERCC1 (Excision Repair Cross Complement Group 1) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details
CSF2RA Polyclonal Conjugated Antibody
MBS9450233-01 0.1 mL (Biotin)

CSF2RA Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CSF2RA Polyclonal Conjugated Antibody
MBS9450233-02 0.1 mL (AF350)

CSF2RA Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CSF2RA Polyclonal Conjugated Antibody
MBS9450233-03 0.1 mL (AF405)

CSF2RA Polyclonal Conjugated Antibody

Sign In for Pricing
View Details