Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 237 (TMEM237)

This Recombinant Bovine Transmembrane protein 237 (TMEM237) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Transmembrane protein 237

UniProt

E1BN97

Expression Region

1-400

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKQVRPPRALPPVPSAIQDDIPLSRPKKKKPRTKTPLASASSEGLVQTAVHRPPEGSE PPTKDSIEHQEAPVQRRQKKTRLPLELETTLTQKKTASPSLLPNENGINVEPDEEPVIQK PRRKTKKTQPAELHYANELGVEDEDIITDEQSSPEQQSVFTAPTGISQPVGKVFVEKSRR FQAADRAELIKTTEKIDVSMDMKPSWTTRDVALSVHRAFRMIGVFSHGFLAGCAVWNIVV IYVLAGDELSDLSNLLQQYKTLAYPFQSLLYLLLALSTVSAFDRIDFAKTSVAIRNFLAL DPRALASFLYFTALVLSLSQQMTSDRIHLYTPSSVNGSLWAEGIEEQVLQPWIVVNLVVA VLVGLSWLFLSYRPGMDLSEELMFSSDVEEYPDKGIKVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF640R conjugate, 0.1mg/mL
BNC401870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
BNC402984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details