Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK757.4 (ZK757.4)

This Recombinant Uncharacterized protein ZK757.4 (ZK757.4) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK757.4

UniProt

Q8I0G4

Expression Region

1-403

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCRDCTRKGGCVYTTFWLVRFLPVVLVSLATGWGIYAYTYELCILSIDNWPQRIIYLFI FYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDL TLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILF LAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLV FLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHGIRANYREIF GSHPLYWFLPVPSSIGDGCKFVMNDMTAMSAAAGNQVFVEMGNVPNGQSHAHPPIAQHHI NLYSEQSSSASEKEIKSVDDEITERSQVSTATTASPSHDSVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALT Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62697R-PerCP-Cy5.5 100 µL

GALT Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
C13orf31 Rabbit Polyclonal Antibody (Biotin)
orb2108218 100 µL

C13orf31 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
IPO5 Antibody Blocking Peptide
orb1510451 500 µg

IPO5 Antibody Blocking Peptide

Sign In for Pricing
View Details
Propionyl Coenzyme A Carboxylase beta (Propionyl-CoA Carboxylase beta Chain Mitochondrial, PCCase Subunit beta, PCCB, Propanoyl-CoA:Carbon Dioxide Ligase Subunit beta, DKFZp451E113) (Biotin) discontinued
P9052-06B-Biotin 200 µL

Propionyl Coenzyme A Carboxylase beta (Propionyl-CoA Carboxylase beta Chain Mitochondrial, PCCase Subunit beta, PCCB, Propanoyl-CoA:Carbon Dioxide Ligase Subunit beta, DKFZp451E113) (Biotin) discontinued

Sign In for Pricing
View Details
Wilms Tumor Protein (WT1) (NM_001198552) Human Tagged ORF Clone Lentiviral Particle
RC231130L4V 200 µL

Wilms Tumor Protein (WT1) (NM_001198552) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Monoclonal CD8 alpha Antibody (YTC182.20) [Alexa Fluor 488]
NB100-64922AF488 0.1 mL

Rat Monoclonal CD8 alpha Antibody (YTC182.20) [Alexa Fluor 488]

Sign In for Pricing
View Details