Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yarrowia lipolytica Peroxisomal biogenesis factor 9 (PEX9)

This Recombinant Yarrowia lipolytica Peroxisomal biogenesis factor 9 (PEX9) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 9, Peroxin-9, Peroxisomal protein PAY2

UniProt

P45817

Expression Region

1-404

Origin

Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMSARVRKMALPSNCDLSDVEMICDNVLGCLEDLDSSRVVSRVTSREDVDESTIGDLIS LDCVSLETPLFSFLFLGVTLFLFLSLLQQSLVFLLGVFLRLVQLVGHFLLLLMGEQIGVI DKAMSHIPLPEVGQHSQQVQIQHLVERRFGLDVVTAIVVIGDNELFQVVGHQFRVGIMSD GQRSQQSQNSGMNVASSSRGRHQLVPDRPGSQLSSQKLSSLVPLARIAAAEIPCAVQQSL SRLFARSVQNRQVQRPHLDPQRQRNIVGVFGVQHGRAVLLCALGGDLIEKRPNQLVRVVK VLVDKFPRRLPKRLVHLVHLGRGSLVHCRCDRVCQQRGCCHLWHCGGHFFVGLVSWIVDE TAACVVFCLFKVVSETQRISSLPRYMHRELNTAGVVWGCGGKHM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details