Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F32G8.4 (F32G8.4)

This Recombinant Uncharacterized protein F32G8.4 (F32G8.4) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Uncharacterized protein F32G8.4

UniProt

Q19978

Expression Region

1-405

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTISYDEEFSSLMLRWRGSIWKAVLKDLIGFYIAYYIVLAFQWYLLDEKGKEYFTGWIMW CEIGAQYIPLSFLLGFFVSLIVARWWEQFNCISWPDKMMIMVSACLPGNENMVVRQTIAR WSSLQAAIAWSGVSVKTLKRFPTERHMVASKLMTEEEYDLYMNTDAPHGKWFIPILWIVN LIKKQKQKGIIDSIQMDMLLKQVYSYRDGFAMLFVYDWIKIPLVYTQVVAIATYGYFFIC LIGRQPKLDQRSMEKEITILFPIFTTFQMLFYLGWLKVGQYLMNPFGEDDDDFELNYVLD RNTAIAHMMASELSDQLPSIGAPMVPAVPHTRASFKIQDVIPKSHLAGFKLSEAEMKLIK PEDLEEHERLMEETKVTNRQRLGTLVRALEKKSRTNATINEDDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details