Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Palmitoyltransferase PFA3 (PFA3)

This Recombinant Debaryomyces hansenii Palmitoyltransferase PFA3 (PFA3) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA3, EC= 2.3.1.-, Protein fatty acyltransferase 3

UniProt

Q6BMV2

Expression Region

1-405

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVYALIVHGCYDTLMTTQE TSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRIRNILSLSKPKYNSANPYD TNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLKSNNSSYRYCTKCSVWKPDRC HHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMYLTAYSGFDFVVSLSILWKFFAD EKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYLVFRNKTTIEFQENRWNFKNDKNGK SFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPSWYYWLLPVTVTNKSIDARLENGINFE IDQDVYDRWCYNAQLQDQLNQQLADYKNRIRMEREANQTTDTNPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), CF594 conjugate, 0.1mg/mL
BNC941022-500 1x 500 µL

Hepatocyte Specific (CPS1/1022), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
BNC880818-500 1x 500 µL

CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF640R conjugate, 0.1mg/mL
BNC401840-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details