Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L248 (MIMI_L248)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L248 (MIMI_L248) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Uncharacterized protein L248

UniProt

Q5UPT3

Expression Region

1-406

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNIQNLCTNPLIILIGTYMSIKYYLFQIDYFNIQFGLYVTFIISLLYGSVRFNSLQQKK LMDGLIFILHVLFVLICFSIKSEIISGTLNTIFYFGFVKTIIISVVIGSFILSELDNNNH NRIIPEKMCCFCKQNIKKIMVTFVKNIDIDPIIYWSKTFFVKLYTEFKNINSVLSKNTRS EIIIDRICLKISLIKMYLYSVIVPYAISSFFGMNNDYKNIINNIDKIDYPGNLDMSFLEQ EVFDSEHLDDLDDLDTPDTLNVPISTNNTDNLNSVKTNQQFNTPVAKSNTKSNRRKKTGK KIRLANQTTSSNSSNNQSPESTGTNNNVVDNKTLLRNKLREKRLARTGSLPTVPQNVDMS MINSLMQNMINNGSLEKIATEFAKNPENVADINNPKLRKLAKSMTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNIP (NM_006472) Human Over-expression Lysate
LY401945 100 µg

TXNIP (NM_006472) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP2C18 Rabbit Polyclonal Antibody
TA375284 100 µL

CYP2C18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF111 Rabbit Polyclonal Antibody
TA370288 100 µL

RNF111 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS510713 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
CD44 Polyclonal Antibody
E-AB-66948-01 60 µL

CD44 Polyclonal Antibody

Sign In for Pricing
View Details
CD44 Polyclonal Antibody
E-AB-66948-02 120 µL

CD44 Polyclonal Antibody

Sign In for Pricing
View Details