Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L248 (MIMI_L248)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L248 (MIMI_L248) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Uncharacterized protein L248

UniProt

Q5UPT3

Expression Region

1-406

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNIQNLCTNPLIILIGTYMSIKYYLFQIDYFNIQFGLYVTFIISLLYGSVRFNSLQQKK LMDGLIFILHVLFVLICFSIKSEIISGTLNTIFYFGFVKTIIISVVIGSFILSELDNNNH NRIIPEKMCCFCKQNIKKIMVTFVKNIDIDPIIYWSKTFFVKLYTEFKNINSVLSKNTRS EIIIDRICLKISLIKMYLYSVIVPYAISSFFGMNNDYKNIINNIDKIDYPGNLDMSFLEQ EVFDSEHLDDLDDLDTPDTLNVPISTNNTDNLNSVKTNQQFNTPVAKSNTKSNRRKKTGK KIRLANQTTSSNSSNNQSPESTGTNNNVVDNKTLLRNKLREKRLARTGSLPTVPQNVDMS MINSLMQNMINNGSLEKIATEFAKNPENVADINNPKLRKLAKSMTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi-Well Plates
DP4MVS-4-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
RSK2 Recombinant Rabbit Monoclonal Antibody [JE63-19]
HA721033 100 µL

RSK2 Recombinant Rabbit Monoclonal Antibody [JE63-19]

Sign In for Pricing
View Details
MALT1 (MALT-Lymphoma Marker) (MT1/3159R), Biotin conjugate, 0.1mg/mL
BNCB3159-100 1x 100 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Bcl2a1a activation kit by CRISPRa
GA200383 1 Kit

Mouse Bcl2a1a activation kit by CRISPRa

Sign In for Pricing
View Details
Inoculating Loops
M4015 1000 Units/Case

Inoculating Loops

Sign In for Pricing
View Details
Human SMEK2 (PPP4R3B) activation kit by CRISPRa
GA111455 1 Kit

Human SMEK2 (PPP4R3B) activation kit by CRISPRa

Sign In for Pricing
View Details