Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-12 (inx-12)

This Recombinant Innexin-12 (inx-12) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

Innexin-12, Protein opu-12

UniProt

O01634

Expression Region

1-408

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVIQNLLSAVSPQPDGDFVDKLNYCATTIGLVLASAFITGWSFVGSPIDCWFPAYYKGW WAEYALDYCYVQNTFFVPFSEDKAERSYNWEQLVADKQNTTSLKQTNQIGYYQWVPFILA LQAMLFYFPVVIWRLFYGMAGQNVTSLCNTCTATEGNEESRKGTITTIAGYISQKRHRNL IVKQLSGFQNRANGSAVITSYLFMKALFLINVLFQFVLLKRMLGVDSYFWGAEVTSDLWS GNEWPETGNFPRVTMCEYEVRNLDNIHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVTI TNTIYWFWRASGTSVSKNFIRPYVEDIDPKVKNNRGKLQQFVSEFLSPDTVFILRLIELN NGKTPVVELIRDMWRRFNTAVPPPYSAPPLLVKDGAPLLKNFQDESEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PILRB Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4670R-BF405 100 µL

PILRB Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Taf1 shRNA (UAS) - Lentiviral mouse Taf1 shRNA (UAS, iRFP) (100)
GTR15177567 1 Vial

Lentiviral mouse Taf1 shRNA (UAS) - Lentiviral mouse Taf1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Pineal Anti-Reproductive Tripeptide (Bovine)
P4198 1 mg

Pineal Anti-Reproductive Tripeptide (Bovine)

Sign In for Pricing
View Details
RIN1 siRNA (h)
sc-40911 10 µM

RIN1 siRNA (h)

Sign In for Pricing
View Details
Topoisomerase I Recombinant Antibody, Cy5.5 Conjugated
bsm-52531R-Cy5.5 100 µL

Topoisomerase I Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
FOLR2 rabbit pAb
ES9661-01 50 µL

FOLR2 rabbit pAb

Sign In for Pricing
View Details