Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yvrN

UniProt

P46324

Expression Region

1-409

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fuom (NM_026928) Mouse Tagged ORF Clone Lentiviral Particle
MR201413L3V 200 µL

Fuom (NM_026928) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Goat Butyrophilin like protein 2 (BTNL2) ELISA Kit
GTR10319004 96 Well

Goat Butyrophilin like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Snx14 Mouse shRNA Lentiviral Particle (Locus ID 244962)
TL507477V 500 µL Each

Snx14 Mouse shRNA Lentiviral Particle (Locus ID 244962)

Sign In for Pricing
View Details
NOD2 siRNA (Human)
MBS8224622-01 15 nmol

NOD2 siRNA (Human)

Sign In for Pricing
View Details
NOD2 siRNA (Human)
MBS8224622-02 30 nmol

NOD2 siRNA (Human)

Sign In for Pricing
View Details
NOD2 siRNA (Human)
MBS8224622-03 5x 30 nmol

NOD2 siRNA (Human)

Sign In for Pricing
View Details