Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yvrN

UniProt

P46324

Expression Region

1-409

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDH2 Adenovirus (Rat)
28266056 1.0 mL

MDH2 Adenovirus (Rat)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque NDUFA4 Protein, His (Fc)-Avi-tagged
NDUFA4-2794R 50 µg

Recombinant Rhesus Macaque NDUFA4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
3,4-Dinitro-1H-pyrazole-5-carboxylic acid
OR13451 1 Each

3,4-Dinitro-1H-pyrazole-5-carboxylic acid

Sign In for Pricing
View Details
Anti-Human CD80 (B7-1) Biotin
MBS696452-01 0.1 mg

Anti-Human CD80 (B7-1) Biotin

Sign In for Pricing
View Details
Anti-Human CD80 (B7-1) Biotin
MBS696452-02 5x 0.1 mg

Anti-Human CD80 (B7-1) Biotin

Sign In for Pricing
View Details
Human PRND Pre-designed siRNA Set B
SI012859B 1 Each

Human PRND Pre-designed siRNA Set B

Sign In for Pricing
View Details