Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yvrN (yvrN) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yvrN

UniProt

P46324

Expression Region

1-409

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABTB2 (NM_145804) Human Tagged Lenti ORF Clone
RC210896L1 10 µg

ABTB2 (NM_145804) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ANKS6 Rabbit Polyclonal Antibody (PE)
orb483502 100 µL

ANKS6 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Gfap Antibody
GWB-MT468I 50 µg

Gfap Antibody

Sign In for Pricing
View Details
ATG9A Antibody Blocking peptide
orb1453018 500 µg

ATG9A Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Rhesus Macaque ATAT1 Protein, His (Fc)-Avi-tagged
ATAT1-264R 50 µg

Recombinant Rhesus Macaque ATAT1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ATP6V1A Antibody, HRP conjugated
A13591-50UL 50 μL

ATP6V1A Antibody, HRP conjugated

Sign In for Pricing
View Details