Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sensor histidine kinase glnK (glnK)

This Recombinant Bacillus subtilis Sensor histidine kinase glnK (glnK) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Sensor histidine kinase glnK, EC= 2.7.13.3

UniProt

P40758

Expression Region

1-410

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPGFLTGAAVFIFRVFLE LWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIMLGFIGFMIEVVSDCVE LTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYETQSREKQTRQQHEHMLMI VSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGRILRLAGEIHEVKKDNQRI FAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQIDFYCSIEGEHDEYHVFIVL SIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNGPGISEKIGDIVFDPGFTSKY DEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAIRLPVRHLIQKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Atp2a3 Plasmid
PVT44147 2 µg

pCMV-SPORT6-Atp2a3 Plasmid

Sign In for Pricing
View Details
Lentiviral human C1orf210 shRNA (UAS) - Lentiviral human C1orf210 shRNA (UAS, RFP) plasmid
GTR15323416 1 Vial

Lentiviral human C1orf210 shRNA (UAS) - Lentiviral human C1orf210 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal OX40 Ligand/TNFSF4 Antibody (R4930 (Oxelumab)) [mFluor Violet 500 SE]
NBP2-52687MFV500 0.1 mL

Rabbit Monoclonal OX40 Ligand/TNFSF4 Antibody (R4930 (Oxelumab)) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
RASA1 (Ras GTPase-activating protein 1, RAS p21 protein activator (GTPase activating protein) 1, CMAVM)
332033 100 µL

RASA1 (Ras GTPase-activating protein 1, RAS p21 protein activator (GTPase activating protein) 1, CMAVM)

Sign In for Pricing
View Details
FGFR1OP Rabbit Polyclonal Antibody (HRP)
orb2107373 100 µL

FGFR1OP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CD45 Antibody
MBS5312901-01 0.1 mg

CD45 Antibody

Sign In for Pricing
View Details