Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Palmitoyltransferase PFA5 (PFA5)

This Recombinant Debaryomyces hansenii Palmitoyltransferase PFA5 (PFA5) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA5, EC= 2.3.1.-, Protein fatty acyltransferase 5

UniProt

Q6BP97

Expression Region

1-411

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFDPKLFKYAWAKRVIPICVILGLGYIDFACFYALGYREIYKFHSHGVAISLWVILAWC EVCVIAYWVLLVVTGPGKAPRVKPFNLYSSEDTSDLTPVPDYFFCDESGYPFWCSQCQSI KLPRTLHSKDRNYCILKFDHYCVWVGTVIGQRNYKYFLNFLIWFLMFFIVTLIYLSRYTK SNYDRGTKDIDHNYIVLYILSGYWILILSSLLAAHLWYVVHNMTTIDDMNIKKVKRYSRW TSNNDKTKRKDVRKIPGEETGIRYINIRYNDTRVIVQYTLNDFPFSFGFKRNWQNLWLNN NRTNGDFTQHESSYSRKRLAISFLLFLVPYVDLVYPSRERINVSDVEKSTLDSLYSHRLI EYEQYNDRLNDKFLDYINSKIKNNEFHMPRYLSPLAEDQQSSSEGSRPDNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400385-100 1x 100 µL

CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details