Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q7A351

Expression Region

1-412

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), CF594 conjugate, 0.1mg/mL
BNC943244-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF640R conjugate, 0.1mg/mL
BNC401074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C5orf22 activation kit by CRISPRa
GA110702 1 Kit

Human C5orf22 activation kit by CRISPRa

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Equine IgG
RAF-431-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Equine IgG

Sign In for Pricing
View Details
MUC2 (Mucin 2) (rMLP/842), CF740 conjugate, 0.1mg/mL
BNC743609-500 1x 500 µL

MUC2 (Mucin 2) (rMLP/842), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF568 conjugate, 0.1mg/mL
BNC682615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details