Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q7A351

Expression Region

1-412

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Anopheles gambiae (African malaria mosquito) AgPPO9 Antibody HRP Conjugated
DZ41838-HRP 200 µL/Vial

Anti-Anopheles gambiae (African malaria mosquito) AgPPO9 Antibody HRP Conjugated

Sign In for Pricing
View Details
Mouse Hmbs (NM_001110251) AAV Particle
MR205538A1V 250 µL

Mouse Hmbs (NM_001110251) AAV Particle

Sign In for Pricing
View Details
RGD1563072 Adenovirus (Rat)
39312056 1.0 mL

RGD1563072 Adenovirus (Rat)

Sign In for Pricing
View Details
JC-1125-2550 Continuous Tapes for Printers
176587 1 Box (1 Label (s) x 1 Roll)

JC-1125-2550 Continuous Tapes for Printers

Sign In for Pricing
View Details
Lentiviral mouse Ip6k2 shRNA (UAS) - Lentiviral mouse Ip6k2 shRNA (UAS, GFP) (100)
GTR15176649 1 Vial

Lentiviral mouse Ip6k2 shRNA (UAS) - Lentiviral mouse Ip6k2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
WD Repeat-Containing Protein 21B (WDR21B) Antibody
abx025967-01 80 µL

WD Repeat-Containing Protein 21B (WDR21B) Antibody

Sign In for Pricing
View Details