Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q7A351

Expression Region

1-412

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (PE)
MBS6183970-01 0.1 mL

LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (PE)

Sign In for Pricing
View Details
LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (PE)
MBS6183970-02 5x 0.1 mL

LMO3 (LIM Domain only 3 (rhombotin-like 2), DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3) (PE)

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-01 1 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-02 2 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-03 5 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-04 10 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details