Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q99QX3

Expression Region

1-412

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLECL1 Human Gene Knockout Kit (CRISPR)
KN210857BN 1 Kit

CLECL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14-3-3 epsilon (YWHAE) Human Gene Knockout Kit (CRISPR)
KN400245 1 Kit

14-3-3 epsilon (YWHAE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) (NM_001118888) Human Over-expression Lysate
LY426530 100 µg

Angiopoietin 2 (ANGPT2) (NM_001118888) Human Over-expression Lysate

Sign In for Pricing
View Details
CKAP1 (TBCB) (NM_001281) Human Recombinant Protein
TP308792 20 µg

CKAP1 (TBCB) (NM_001281) Human Recombinant Protein

Sign In for Pricing
View Details
Btg1 Mouse Gene Knockout Kit (CRISPR)
KN502306 1 Kit

Btg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), CF594 conjugate, 0.1mg/mL
BNC940015-500 1x 500 µL

CD56 / NCAM (123C3.D5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details