Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q99QX3

Expression Region

1-412

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT4 (Center) Rabbit Polyclonal Antibody
AP18243PU-N 200 µL

WNT4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 650 conjugated (40 µg)
AS07 260-DL650 40 µg

Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
PerCP Anti-Mouse/Human CD11b Antibody
RD20949F-01 25 µg

PerCP Anti-Mouse/Human CD11b Antibody

Sign In for Pricing
View Details
PerCP Anti-Mouse/Human CD11b Antibody
RD20949F-02 100 µg

PerCP Anti-Mouse/Human CD11b Antibody

Sign In for Pricing
View Details
C1orf86 (FAAP20) (NM_001282670) Human Tagged ORF Clone
RG237172 10 µg

C1orf86 (FAAP20) (NM_001282670) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse MMP-7 (Matrix Metalloproteinase 7) CLIA Kit
E-CL-M0494-01 24 Tests

Mouse MMP-7 (Matrix Metalloproteinase 7) CLIA Kit

Sign In for Pricing
View Details