Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type IV pilus assembly protein TapC (tapC)

This Recombinant Type IV pilus assembly protein TapC (tapC) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Type IV pilus assembly protein TapC

UniProt

P45793

Expression Region

1-413

Origin

Aeromonas hydrophila

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATLTQKQNAPKKVFAFRWSGVNRKGQKVSGELQADSINTVKAELRKQGVNVTKVSKKSQ GLFSKGGAKIKPMDIAIVSRQITTMLSAGVPLVQSLQIIARSHEKASMRELMGQIAADVE TGTPMSEALRRHPRHFDALYCDLVEAGEQSGALETIYDRIATYREKSEALKSKIKKAMFY PAMVILVAIVVTSILLLFVIPQFEDIFKSFGAELPIFTQFVIGISRFMQHWWYVIFGGTA FAIFLYVRAWRASQKVKDNTDKFILTIPVVGMILHKAAMARFARTLSTTFSAGIPLVDAL ISAAGASGNYVYRTAVMAIRNEVVAGMQINVAMRTVDLFPDMVIQMVMIGEESGAIDDML SKVATIFEQEVDDLVDGLTSLLEPLIMVVLGVLVGGMVVAMYLPIFKLGDLVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP78 BiP Rabbit pAb
orb2715432-01 20 ul

GRP78 BiP Rabbit pAb

Sign In for Pricing
View Details
GRP78 BiP Rabbit pAb
orb2715432-02 50 µL

GRP78 BiP Rabbit pAb

Sign In for Pricing
View Details
GRP78 BiP Rabbit pAb
orb2715432-03 100 µL

GRP78 BiP Rabbit pAb

Sign In for Pricing
View Details
Anti-SRCAP antibody
STJ119919 100 µl

Anti-SRCAP antibody

Sign In for Pricing
View Details
Mouse Involucrin (IVL) ELISA kit
GTR10435190 96 Well

Mouse Involucrin (IVL) ELISA kit

Sign In for Pricing
View Details
PROCR Rabbit Polyclonal Antibody (RBITC)
orb1036344 100 µL

PROCR Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details