Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type IV pilus assembly protein TapC (tapC)

This Recombinant Type IV pilus assembly protein TapC (tapC) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Type IV pilus assembly protein TapC

UniProt

P45793

Expression Region

1-413

Origin

Aeromonas hydrophila

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATLTQKQNAPKKVFAFRWSGVNRKGQKVSGELQADSINTVKAELRKQGVNVTKVSKKSQ GLFSKGGAKIKPMDIAIVSRQITTMLSAGVPLVQSLQIIARSHEKASMRELMGQIAADVE TGTPMSEALRRHPRHFDALYCDLVEAGEQSGALETIYDRIATYREKSEALKSKIKKAMFY PAMVILVAIVVTSILLLFVIPQFEDIFKSFGAELPIFTQFVIGISRFMQHWWYVIFGGTA FAIFLYVRAWRASQKVKDNTDKFILTIPVVGMILHKAAMARFARTLSTTFSAGIPLVDAL ISAAGASGNYVYRTAVMAIRNEVVAGMQINVAMRTVDLFPDMVIQMVMIGEESGAIDDML SKVATIFEQEVDDLVDGLTSLLEPLIMVVLGVLVGGMVVAMYLPIFKLGDLVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IRF3 Antibody (PCRP-IRF3-3B2) [Janelia Fluor 549]
NBP3-14106JF549 0.1 mL

Mouse Monoclonal IRF3 Antibody (PCRP-IRF3-3B2) [Janelia Fluor 549]

Sign In for Pricing
View Details
Lentiviral human CDPF1 shRNA (UAS) - Lentiviral human CDPF1 shRNA (UAS, iRFP) plasmid
GTR15320335 1 Vial

Lentiviral human CDPF1 shRNA (UAS) - Lentiviral human CDPF1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NDNL2 (Necdin-like 2, HCA4, MAGEG1, MAGEL3, NSE3, NSMCE3) (APC)
MBS6170088-01 0.1 mL

NDNL2 (Necdin-like 2, HCA4, MAGEG1, MAGEL3, NSE3, NSMCE3) (APC)

Sign In for Pricing
View Details
NDNL2 (Necdin-like 2, HCA4, MAGEG1, MAGEL3, NSE3, NSMCE3) (APC)
MBS6170088-02 5x 0.1 mL

NDNL2 (Necdin-like 2, HCA4, MAGEG1, MAGEL3, NSE3, NSMCE3) (APC)

Sign In for Pricing
View Details
Fblim1 (NM_001007554) Rat Tagged ORF Clone Lentiviral Particle
RR213830L3V 200 µL

Fblim1 (NM_001007554) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal Cdk7 Antibody (MO-1)
NBP3-30978-100ug 100 µg

Mouse Monoclonal Cdk7 Antibody (MO-1)

Sign In for Pricing
View Details