Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-3 protein (Gja3)

This Recombinant Mouse Gap junction alpha-3 protein (Gja3) spans the amino acid sequence from region 2-417.

Product Specifications

Product Name Alternative

Gap junction alpha-3 protein, Connexin-46, Cx46

UniProt

Q64448

Expression Region

2-417

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPGC ENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEELLRRDNPQH GRGREPMRTGSPRDPPLRDDRGKVRIAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFQL QPLYRCDRWPCPNTVDCFISRPTEKTIFVIFMLAVACASLVLNMLEIYHLGWKKLKQGVT NHFNPDASEARHKPLDPLPTATSSGPPSVSIGFPPYYTHPACPTVQAKAIGFPGAPLSPA DFTVVTLNDAQGRNHPVKHCNGHHLTTEQNWTRQVAEQQTPASKPSSAASSPDGRKGLID SSGSSLQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA (PTPRC/1131), 0.2mg/mL
BNUB1131-500 1x 500 µL

CD45RA (PTPRC/1131), 0.2mg/mL

Sign In for Pricing
View Details
Human EPOR (Erythropoietin Receptor) CLIA Kit
E-CL-H0905-01 24 Tests

Human EPOR (Erythropoietin Receptor) CLIA Kit

Sign In for Pricing
View Details
Human EPOR (Erythropoietin Receptor) CLIA Kit
E-CL-H0905-02 48 Tests

Human EPOR (Erythropoietin Receptor) CLIA Kit

Sign In for Pricing
View Details
Human EPOR (Erythropoietin Receptor) CLIA Kit
E-CL-H0905-03 96 Tests

Human EPOR (Erythropoietin Receptor) CLIA Kit

Sign In for Pricing
View Details
EBF4 (NM_001110514) Human Over-expression Lysate
LC426327 20 µg

EBF4 (NM_001110514) Human Over-expression Lysate

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF640R conjugate, 0.1mg/mL
BNC401865-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details