Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 3B (Htr3b)

This Recombinant Mouse 5-hydroxytryptamine receptor 3B (Htr3b) spans the amino acid sequence from region 22-437.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3B, 5-HT3-B, 5-HT3B, Serotonin receptor 3B

UniProt

Q9JHJ5

Expression Region

22-437

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLDVDVQNQKLKTSVWYR EVWNDEFLSWNSSLFDEIQEISLPLSALWAPDIIINEFVDVERSPDLPYVYVNSSGTIRN HKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDIDLGFLRNREDIENDKRAFMNDS EWQLLSVSSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGSFYLPP NCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTPLIGVFFTVCMALLVLSLSKSILLIK FLYEERHSGQERPLMCLQGDSDAEESRLYLGAPRADVTESPVHQEHRVPSDTLKDFWFQF RSINNSLRTRDQIHQKEVEWLAILYRFDQLLFRIYLAVLGLYTVTLCSLWALWSRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015, CHORDC3, Melusin, MGC119214) (MaxLight 750)
MBS6400887-01 0.1 mL

ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015, CHORDC3, Melusin, MGC119214) (MaxLight 750)

Sign In for Pricing
View Details
ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015, CHORDC3, Melusin, MGC119214) (MaxLight 750)
MBS6400887-02 5x 0.1 mL

ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015, CHORDC3, Melusin, MGC119214) (MaxLight 750)

Sign In for Pricing
View Details
Os07g0190800 Antibody
orb842686 2 mg

Os07g0190800 Antibody

Sign In for Pricing
View Details
AMIGO1, CT (AMIGO1, ALI2, AMIGO, KIAA1163, Amphoterin-induced protein 1, AMIGO-1, Alivin-2) (Azide free) (HRP)
MBS6273250-01 0.2 mL

AMIGO1, CT (AMIGO1, ALI2, AMIGO, KIAA1163, Amphoterin-induced protein 1, AMIGO-1, Alivin-2) (Azide free) (HRP)

Sign In for Pricing
View Details
AMIGO1, CT (AMIGO1, ALI2, AMIGO, KIAA1163, Amphoterin-induced protein 1, AMIGO-1, Alivin-2) (Azide free) (HRP)
MBS6273250-02 5x 0.2 mL

AMIGO1, CT (AMIGO1, ALI2, AMIGO, KIAA1163, Amphoterin-induced protein 1, AMIGO-1, Alivin-2) (Azide free) (HRP)

Sign In for Pricing
View Details
SLC4A8 (Solute Carrier Family 4, Sodium bicarbonate cotransporter, Member 8, DKFZp761B2318, FLJ46462, NBC3) (Biotin)
251761-Biotin 100 µL

SLC4A8 (Solute Carrier Family 4, Sodium bicarbonate cotransporter, Member 8, DKFZp761B2318, FLJ46462, NBC3) (Biotin)

Sign In for Pricing
View Details