Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 3B (Htr3b)

This Recombinant Mouse 5-hydroxytryptamine receptor 3B (Htr3b) spans the amino acid sequence from region 22-437.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3B, 5-HT3-B, 5-HT3B, Serotonin receptor 3B

UniProt

Q9JHJ5

Expression Region

22-437

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLDVDVQNQKLKTSVWYR EVWNDEFLSWNSSLFDEIQEISLPLSALWAPDIIINEFVDVERSPDLPYVYVNSSGTIRN HKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDIDLGFLRNREDIENDKRAFMNDS EWQLLSVSSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGSFYLPP NCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTPLIGVFFTVCMALLVLSLSKSILLIK FLYEERHSGQERPLMCLQGDSDAEESRLYLGAPRADVTESPVHQEHRVPSDTLKDFWFQF RSINNSLRTRDQIHQKEVEWLAILYRFDQLLFRIYLAVLGLYTVTLCSLWALWSRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5D13 Rabbit Polyclonal Antibody (FITC)
orb2085561 100 µL

OR5D13 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human Z587B ELISA Kit
E106540 1 Each

Human Z587B ELISA Kit

Sign In for Pricing
View Details
Human SMTNL1 Pre-designed siRNA Set B
SI015380B 1 Each

Human SMTNL1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
W/W026/NL336/RFL-390X590-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
304531 1 Pack (1 Panel (s) x 1 Pack)

W/W026/NL336/RFL-390X590-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 405)
MBS6198392-01 0.1 mL

TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 405)

Sign In for Pricing
View Details
TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 405)
MBS6198392-02 5x 0.1 mL

TLR8 (Toll-like Receptor 8, CD288, MGC119599, MGC119600) (MaxLight 405)

Sign In for Pricing
View Details