Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ORF2

This Recombinant Uncharacterized protein ORF2 spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF2

UniProt

O33369

Expression Region

1-417

Origin

Neisseria gonorrhoeae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RQSLRLLSDGNDSXDIRHLSRLLDNLGSVDQQFRQLRHSDSPAENDRMGDTRIAALETGS FKNTWQAIRPQLNLESGVFRHAVRLSLVVAAACTIVEALNLNLGYWILLTRLFVCQPNYT ATKSRVYQRIAGTVLGVIVGSLVPYFTPSVETKLWIVIAGTTLFFMTRTYKYSFSTFFIT IQALTSLSLAGLDVYAAMPVRIIDTIIGASLAWAAVSYLWPDWKYLTLERTAALAVCSSG TYLQKIAERLKTGETGDDIEYRITRRRAHEHTAALSSTLSDMSSEPAKFADTCNPALPCS KPATALTGYISALGHTAAKCTKNAAPTLPHSSTLPPNTPPTSSNTCPTWDPTTFRRHWIH CAANSAPSAPAAAEHKATSSSNSSNSSPGSSNPTTAPTDKFRTGSPKTQPEKISAFW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geldanamycin-FITC
BA4184-1 1 mg

Geldanamycin-FITC

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1093904-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1093904-02 0.1 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1093904-03 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1093904-04 0.02 mg (Baculovirus)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1093904-05 0.1 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details