Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hyaluronan synthase (hasA)

This Recombinant Hyaluronan synthase (hasA) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Hyaluronan synthase, EC= 2.4.1.212, Hyaluronate synthase, Hyaluronic acid synthase, HA synthase

UniProt

P0C0H1

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFKKTLIVLSFIFLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGK PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFKESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMIKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC91 Knockout 786-O Polyclonal Cells
ARG43114 1 Million

CCDC91 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
RAB3B (Ras-related Protein Rab-3B) (APC)
132205-APC 100 µL

RAB3B (Ras-related Protein Rab-3B) (APC)

Sign In for Pricing
View Details
FITC Rat IgM, kappa Isotype Control
MBS4514674-01 20 Tests

FITC Rat IgM, kappa Isotype Control

Sign In for Pricing
View Details
FITC Rat IgM, kappa Isotype Control
MBS4514674-02 50 Tests

FITC Rat IgM, kappa Isotype Control

Sign In for Pricing
View Details
FITC Rat IgM, kappa Isotype Control
MBS4514674-03 200 Tests

FITC Rat IgM, kappa Isotype Control

Sign In for Pricing
View Details
FITC Rat IgM, kappa Isotype Control
MBS4514674-04 100 Tests

FITC Rat IgM, kappa Isotype Control

Sign In for Pricing
View Details