Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hyaluronan synthase (hasA)

This Recombinant Hyaluronan synthase (hasA) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Hyaluronan synthase, EC= 2.4.1.212, Hyaluronate synthase, Hyaluronic acid synthase, HA synthase

UniProt

Q8NKX1

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M18

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFKKTLIVLSFIFLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGK PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRD@ (T Cell Receptor delta Locus, FLJ52034, FLJ52576, FLJ53668, FLJ54555, FLJ55265, FLJ56790, TCRD, TCRDV1, TRD) (PE)
134696-PE 100 µL

TRD@ (T Cell Receptor delta Locus, FLJ52034, FLJ52576, FLJ53668, FLJ54555, FLJ55265, FLJ56790, TCRD, TCRDV1, TRD) (PE)

Sign In for Pricing
View Details
PPP1CA (Serine/Threonine-Protein Phosphatase PP1-Alpha Catalytic Subunit, Protein Phosphatase 1 Catalytic Subunit Alpha)
489172 100 µL

PPP1CA (Serine/Threonine-Protein Phosphatase PP1-Alpha Catalytic Subunit, Protein Phosphatase 1 Catalytic Subunit Alpha)

Sign In for Pricing
View Details
Mouse POU domain, class 2, transcription factor 2 ELISA Kit
MBS2880724-01 48 Well

Mouse POU domain, class 2, transcription factor 2 ELISA Kit

Sign In for Pricing
View Details
Mouse POU domain, class 2, transcription factor 2 ELISA Kit
MBS2880724-02 96 Well

Mouse POU domain, class 2, transcription factor 2 ELISA Kit

Sign In for Pricing
View Details
Mouse POU domain, class 2, transcription factor 2 ELISA Kit
MBS2880724-03 5x 96 Well

Mouse POU domain, class 2, transcription factor 2 ELISA Kit

Sign In for Pricing
View Details
Mouse POU domain, class 2, transcription factor 2 ELISA Kit
MBS2880724-04 10x 96 Well

Mouse POU domain, class 2, transcription factor 2 ELISA Kit

Sign In for Pricing
View Details