Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-2 (inx-2)

This Recombinant Innexin-2 (inx-2) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Innexin-2, Protein opu-2

UniProt

Q9U3K5

Expression Region

1-419

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGFFGPLYEQLVGMLRKQQGQLAFDTIDRVNAWFTPFVLVAMTLAISCKQYFGQPIKCW TPREFSGSWDGYVHDFCFIENTYFVPNGTEVTDEARGGRHINYYRWVPLVLLFQAAMFVL PYHLWNLFHKRTTINLKGSLRFFEGALKKLEPAQACESFAGEIWNRLSDIRNSSNKLYGF QATINYFLLKLGFIVNCILQMVLLKHFLDVDDYFWGFFHLWNVEFKGTAEKEDSIFPRIV LCDFKVRNLGQQHQHTVSCIMILNMIIEKLYICFYFWLIFVFVVTTAGMIHFAFQILFRR HSLIPTNLNNKNKMNPTRSHEFIKDYLNFDGCLLLTYVDAQFGAFRTSQVIDGLVHRFTN ELDSDSSAVTSLNEDHPERYVAFNTDTIPMDRYARKHHSLIEEVDGPSAPPANEEKKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD197/CCR7 Antibody[G043H7]
FCE3038-01 20 Tests

PE Anti-Human CD197/CCR7 Antibody[G043H7]

Sign In for Pricing
View Details
PE Anti-Human CD197/CCR7 Antibody[G043H7]
FCE3038-02 100 Tests

PE Anti-Human CD197/CCR7 Antibody[G043H7]

Sign In for Pricing
View Details
PE Anti-Human CD197/CCR7 Antibody[G043H7]
FCE3038-03 2x 100 Tests

PE Anti-Human CD197/CCR7 Antibody[G043H7]

Sign In for Pricing
View Details
Lentiviral human MOB1B shRNA (UAS) - Lentiviral human MOB1B shRNA (UAS) (25)
GTR15153629 1 Vial

Lentiviral human MOB1B shRNA (UAS) - Lentiviral human MOB1B shRNA (UAS) (25)

Sign In for Pricing
View Details
Osteoblast Specific Factor 2 (OSF-2, Periostin, Fasciclin-I like) (FITC)
MBS6491181-01 0.2 mL

Osteoblast Specific Factor 2 (OSF-2, Periostin, Fasciclin-I like) (FITC)

Sign In for Pricing
View Details
Osteoblast Specific Factor 2 (OSF-2, Periostin, Fasciclin-I like) (FITC)
MBS6491181-02 5x 0.2 mL

Osteoblast Specific Factor 2 (OSF-2, Periostin, Fasciclin-I like) (FITC)

Sign In for Pricing
View Details