Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Hyaluronan synthase (hasA)

This Recombinant Streptococcus pyogenes serotype M3 Hyaluronan synthase (hasA) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Hyaluronan synthase, EC= 2.4.1.212, Hyaluronate synthase, Hyaluronic acid synthase, HA synthase

UniProt

P0DB61

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFKKTLIVLSFICLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGN PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Toll Like Receptor 1 (TLR1) ELISA Kit
orb782185-01 48 Tests

Rat Toll Like Receptor 1 (TLR1) ELISA Kit

Sign In for Pricing
View Details
Rat Toll Like Receptor 1 (TLR1) ELISA Kit
orb782185-02 96 Tests

Rat Toll Like Receptor 1 (TLR1) ELISA Kit

Sign In for Pricing
View Details
KAT13A / SRC1 Rabbit mAb
59771 50 µL

KAT13A / SRC1 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Anti-LRP1B/LRP1B Polyclonal Antibody
PAV2156 100 μL

Rabbit Anti-LRP1B/LRP1B Polyclonal Antibody

Sign In for Pricing
View Details
FAM55D sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20056111 3x 1.0 µg

FAM55D sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human Oxysterol Binding Protein Like Protein 10, OSBPL10 ELISA Kit
MBS166712-01 48 Well

Human Oxysterol Binding Protein Like Protein 10, OSBPL10 ELISA Kit

Sign In for Pricing
View Details