Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Hyaluronan synthase (hasA)

This Recombinant Streptococcus pyogenes serotype M3 Hyaluronan synthase (hasA) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Hyaluronan synthase, EC= 2.4.1.212, Hyaluronate synthase, Hyaluronic acid synthase, HA synthase

UniProt

P0DB61

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFKKTLIVLSFICLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGN PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pheniramine-d6 Maleate
TRC-P297202-2.5MG 2.5 mg

Pheniramine-d6 Maleate

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Elongation factor 4 (lepA), partial
MBS1096126 Inquire

Recombinant Azotobacter vinelandii Elongation factor 4 (lepA), partial

Sign In for Pricing
View Details
DDX5 antibody - C-terminal region (ARP36365_T100)
ARP36365_T100 100 µL

DDX5 antibody - C-terminal region (ARP36365_T100)

Sign In for Pricing
View Details
Myosin Phosphatase 2 (PPP1R12B) (NM_002481) Human Tagged ORF Clone
RG221975 10 µg

Myosin Phosphatase 2 (PPP1R12B) (NM_002481) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZIC4 (Zic Family Member 4, Zinc Family Member 4 Protein HZIC4, Zinc finger Protein of the Cerebellum 4, FLJ42609, FLJ45833) (APC)
207959-APC 100 µL

ZIC4 (Zic Family Member 4, Zinc Family Member 4 Protein HZIC4, Zinc finger Protein of the Cerebellum 4, FLJ42609, FLJ45833) (APC)

Sign In for Pricing
View Details
IKK beta Recombinant Antibody, APC Conjugated
bsm-62794R-APC-TR 20 µL

IKK beta Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details