Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hyaluronan synthase (hasA)

This Recombinant Hyaluronan synthase (hasA) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Hyaluronan synthase, EC= 2.4.1.212, Hyaluronate synthase, Hyaluronic acid synthase, HA synthase

UniProt

P0DB60

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFKKTLIVLSFICLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGN PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD7 Mouse mAb Antibody
orb3063621-01 50 µL

SETD7 Mouse mAb Antibody

Sign In for Pricing
View Details
SETD7 Mouse mAb Antibody
orb3063621-02 100 µL

SETD7 Mouse mAb Antibody

Sign In for Pricing
View Details
Semaphorin 3E Blocking Peptide
CBP2418-01 1 mg

Semaphorin 3E Blocking Peptide

Sign In for Pricing
View Details
Semaphorin 3E Blocking Peptide
CBP2418-02 5 mg

Semaphorin 3E Blocking Peptide

Sign In for Pricing
View Details
Lentiviral human BIN1 shRNA (UAS) - Lentiviral human BIN1 shRNA (UAS, GFP) (25)
GTR15317495 1 Vial

Lentiviral human BIN1 shRNA (UAS) - Lentiviral human BIN1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Cyclin L Rabbit Polyclonal Antibody (PE-Cy5.5)
orb884545 100 µL

Cyclin L Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details