Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Putative zinc metalloprotease SPs1691 (eep)

This Recombinant Streptococcus pyogenes serotype M3 Putative zinc metalloprotease SPs1691 (eep) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Putative zinc metalloprotease SPs1691, EC= 3.4.24.-

UniProt

P0DD33

Expression Region

1-419

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGIITFIIIFGILVIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRML PLGGYVRMAGWGDDKTEIKTGTPASLTLNEQGFVKRINLSQSKLDPTSLPMHVTGYDLED QLSITGLVLEETKTYKVAHDATIVEEDGTEIRIAPLDVQYQNASIGGRLITNFAGPMNNF ILGIVVFILLVFLQGGMPDFSSNHVRVQENGAAAKAGLRDNDQIVAINGYKVNSWNDLTE AVNLATRDLGPSQTIKVTYKSHQRLKTVAVKPQKHAKTYTIGVKASLKTGFKDKLLGGLE LAWSGAFTILNALKGLITGFSLNKLGGPVAMYDMSNQAAQNGLESVLSLMAMLSINLGIF NLIPIPALDGGKILMNIIEAIRRKPIKQETEAYITLAGVAIMVVLMIAVTWNDIMRVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYGO1 Antibody
KC-42444-01 50 μL

PYGO1 Antibody

Sign In for Pricing
View Details
PYGO1 Antibody
KC-42444-02 100 µL

PYGO1 Antibody

Sign In for Pricing
View Details
PYGO1 Antibody
KC-42444-03 1 mL

PYGO1 Antibody

Sign In for Pricing
View Details
HADHSC (HADH) Human Gene Knockout Kit (CRISPR)
KN401752 1 Kit

HADHSC (HADH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP1 (NM_002421) Human Over-expression Lysate
LY419340 100 µg

MMP1 (NM_002421) Human Over-expression Lysate

Sign In for Pricing
View Details
SATB1 Human Gene Knockout Kit (CRISPR)
KN200421RB 1 Kit

SATB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details