Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 3C (HTR3C)

This Recombinant Human 5-hydroxytryptamine receptor 3C (HTR3C) spans the amino acid sequence from region 28-447.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3C, 5-HT3-C, 5-HT3C, Serotonin receptor 3C

UniProt

Q8WXA8

Expression Region

28-447

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTS FLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGLTAYISSE GRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRK VIQTQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDAL SFYLPAESENRAPFKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETV FITYLLHVATTQPPPMPRWLHSLLLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGE LAGKKLGPRETEPDGGSGWTKTQLMELWVQFSHAMDTLLFRLYLLFMASSILTVIVLWNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZIM3 activation kit by CRISPRa
GA114424 1 Kit

Human ZIM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Lair1 Mouse Gene Knockout Kit (CRISPR)
KN309105LP 1 Kit

Lair1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL18 Rabbit Polyclonal Antibody
AP33222PU-N 50 µL

RPL18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC1A4 activation kit by CRISPRa
GA104434 1 Kit

Human SLC1A4 activation kit by CRISPRa

Sign In for Pricing
View Details
Cdc20 (AR12), CF568 conjugate, 0.1mg/mL
BNC680672-100 1x 100 µL

Cdc20 (AR12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCDC78 activation kit by CRISPRa
GA114829 1 Kit

Human CCDC78 activation kit by CRISPRa

Sign In for Pricing
View Details