Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 3C (HTR3C)

This Recombinant Human 5-hydroxytryptamine receptor 3C (HTR3C) spans the amino acid sequence from region 28-447.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3C, 5-HT3-C, 5-HT3C, Serotonin receptor 3C

UniProt

Q8WXA8

Expression Region

28-447

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTS FLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGLTAYISSE GRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRK VIQTQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDAL SFYLPAESENRAPFKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETV FITYLLHVATTQPPPMPRWLHSLLLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGE LAGKKLGPRETEPDGGSGWTKTQLMELWVQFSHAMDTLLFRLYLLFMASSILTVIVLWNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate
LY401105 100 µg

TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL7B Mouse Monoclonal Antibody [Clone ID: OTI3F6]
CF809530 100 µg

BCL7B Mouse Monoclonal Antibody [Clone ID: OTI3F6]

Sign In for Pricing
View Details
FUBP3 Antibody
8C15743-AAT 50 µg

FUBP3 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR562505 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Desmin,  20nm
GM-28-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Desmin, 20nm

Sign In for Pricing
View Details
Armt1 Mouse Gene Knockout Kit (CRISPR)
KN500149 1 Kit

Armt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details