Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B)

This Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B) spans the amino acid sequence from region 22-441.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3B, 5-HT3-B, 5-HT3B, Serotonin receptor 3B

UniProt

O95264

Expression Region

22-441

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTS VWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSG TIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAF LNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSF YLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSI VLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEV WSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CellQuanti-Blue™ Cell Viability Assay Kits
CQBL-05K 5000 Tests

CellQuanti-Blue™ Cell Viability Assay Kits

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
CD31 (PECAM1) Human Gene Knockout Kit (CRISPR)
KN208654BN 1 Kit

CD31 (PECAM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: OTI1B12]
CF811648 100 µg

IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: OTI1B12]

Sign In for Pricing
View Details