Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B)

This Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B) spans the amino acid sequence from region 22-441.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 3B, 5-HT3-B, 5-HT3B, Serotonin receptor 3B

UniProt

O95264

Expression Region

22-441

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTS VWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSG TIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAF LNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSF YLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSI VLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEV WSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dual Oxidase 2 (DUOX2) ELISA Kit
RD-DUOX2-Ra-01 96 Tests

Rat Dual Oxidase 2 (DUOX2) ELISA Kit

Sign In for Pricing
View Details
Rat Dual Oxidase 2 (DUOX2) ELISA Kit
RD-DUOX2-Ra-02 48 Tests

Rat Dual Oxidase 2 (DUOX2) ELISA Kit

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC27A6 (NM_001017372) Human Over-expression Lysate
LY422766 100 µg

SLC27A6 (NM_001017372) Human Over-expression Lysate

Sign In for Pricing
View Details
HA Tag (16.43), CF568 conjugate, 0.1mg/mL
BNC682543-500 1x 500 µL

HA Tag (16.43), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PQBP1 (NM_001032384) Human Over-expression Lysate
LC422320 20 µg

PQBP1 (NM_001032384) Human Over-expression Lysate

Sign In for Pricing
View Details