Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM)

This Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Uncharacterized glycosyltransferase ydaM, EC= 2.4.-.-

UniProt

P96587

Expression Region

1-420

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMID2 Polyclonal Antibody, Cy5 Conjugated
bs-14582R-Cy5 100 µL

EMID2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Olfactory receptor 2C3 Antibody
E18-9139-1 50 µg - 50 µL

Olfactory receptor 2C3 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal EHHADH Antibody (OTI2C4) [PerCP]
NBP2-70625PCP 0.1 mL

Mouse Monoclonal EHHADH Antibody (OTI2C4) [PerCP]

Sign In for Pricing
View Details
JDP2 Knockout AGS Polyclonal Cells
ARG27086 1 Million

JDP2 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Porcine IL-4 (Interleukin 4) ELISA Kit
MBS2513320-01 24 Tests

Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
Porcine IL-4 (Interleukin 4) ELISA Kit
MBS2513320-02 48 Tests

Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details