Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM)

This Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Uncharacterized glycosyltransferase ydaM, EC= 2.4.-.-

UniProt

P96587

Expression Region

1-420

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA1 (Protocadherin gamma-A1, PCDH-gamma-A1, MGC138287, MGC138289, PCDH-GAMMA-A1) (AP) discontinued
130971-AP 100 µL

PCDHGA1 (Protocadherin gamma-A1, PCDH-gamma-A1, MGC138287, MGC138289, PCDH-GAMMA-A1) (AP) discontinued

Sign In for Pricing
View Details
MC3T3-E1 Cells
T9947 1x106 cells / 1.0 mL

MC3T3-E1 Cells

Sign In for Pricing
View Details
Foxp1 AAV siRNA Pooled Vector
20794164 1.0 µg

Foxp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LRRC61 (NM_001142928) Human Tagged ORF Clone
RC226959 10 µg

LRRC61 (NM_001142928) Human Tagged ORF Clone

Sign In for Pricing
View Details
SARS-CoV-2 3CLpro-IN-17
T79660-01 5 mg

SARS-CoV-2 3CLpro-IN-17

Sign In for Pricing
View Details
SARS-CoV-2 3CLpro-IN-17
T79660-02 50 mg

SARS-CoV-2 3CLpro-IN-17

Sign In for Pricing
View Details